Mini Tabletop Butane Gas Burner with Flame Head for Siphon Coffee Heater Maker Mocha Pot Stove (No Gas)
 |
Buy Mini Tabletop Butane Gas Burner with Flame Head for Siphon Coffee Heater Maker Mocha Pot Stove (No Gas)
When you make a purchase through links on our site, we may receive a affiliate commission.
Mini Tabletop Butane Gas Burner with Flame Head for Siphon Coffee Heater Maker Mocha Pot Stove(No Gas) | £26.79 |  | |||
Newimproveddesignwithceramicflameheadprovidesmoreefficientburning. Providesacontrollableheatsourceforthesiphon,greatlyincreasingbrewingaccuracy.
The product description is generated based on data from online stores. Before purchasing be sure to verify all information directly with the seller.
Which hob material is better to choose?All you need to know about hobs, to make operation and maintenance a comfortable experience
Pyrolysis, catalysis, hydrolysis: what is the most effective method of cleaning an oven?Let's figure out what catalytic, pyrolytic and hydrolytic oven cleaning are and what are their advantages
How to place an order?How to add store?
Remember that the online store is responsible for the accuracy of information regarding price, warranty, and delivery!
We recommendCompare using chart →
gas, enamel, gas 5 pcs, turbo burner, auto ignition, gas control, electric oven, 115 L, 3.2 kW, grill, energy consumption A
retro, gas, enamel, gas 6 pcs, turbo burner, auto ignition, gas control, electric oven, 61 L, additional chamber, grill, energy consumption A
electric, glass ceramics, induction 5 pcs, heat indicator, electric oven, 79 L, additional chamber, grill, child lock, energy consumption A
electric, glass ceramics, hi-light 5 pcs, heat indicator, electric oven, 65 L, additional chamber, grill, child lock, energy consumption A
gas, enamel, gas 7 pcs, turbo burner, gas control, gas oven, 59 L, additional chamber, grill, energy consumption A+
retro, gas, enamel, gas 4 pcs, turbo burner, auto ignition, gas control, electric oven, 61 L, 5.5 kW, additional chamber, grill, energy consumption A
retro, electric, glass ceramics (Schott Ceran), induction 5 pcs, heat indicator, electric oven, 63 L, additional chamber, grill, energy consumption A
electric, enamel, cast iron 4 pcs, electric oven, 58 L, additional chamber, grill, energy consumption A
gas, enamel, gas 5 pcs, turbo burner, auto ignition, gas control, electric oven, 82 L, additional chamber, grill, energy consumption A
electric, glass ceramics, hi-light 5 pcs, heat indicator, electric oven, 71 L, additional chamber, grill, child lock
electric, glass ceramics, hi-light 4 pcs, heat indicator, electric oven, 58 L, additional chamber, grill, energy consumption A