Mini Tabletop Butane Gas Burner with Flame Head for Siphon Coffee Heater Maker Mocha Pot Stove (No Gas)
![]() |
Buy Mini Tabletop Butane Gas Burner with Flame Head for Siphon Coffee Heater Maker Mocha Pot Stove (No Gas)
When you make a purchase through links on our site, we may receive a affiliate commission.
Mini Tabletop Butane Gas Burner with Flame Head for Siphon Coffee Heater Maker Mocha Pot Stove(No Gas) | £26.79 | ||||
Newimproveddesignwithceramicflameheadprovidesmoreefficientburning. Providesacontrollableheatsourceforthesiphon,greatlyincreasingbrewingaccuracy.
The product description is generated based on data from online stores. Before purchasing be sure to verify all information directly with the seller.

Which hob material is better to choose?All you need to know about hobs, to make operation and maintenance a comfortable experience

Pyrolysis, catalysis, hydrolysis: what is the most effective method of cleaning an oven?Let's figure out what catalytic, pyrolytic and hydrolytic oven cleaning are and what are their advantages
How to place an order?How to add store?
Remember that the online store is responsible for the accuracy of information regarding price, warranty, and delivery!
We recommendCompare using chart →












