Hunter PGP-04 Ultra

This suction hose is a perfect tool for domestic waterworks, water filters, garden pumps and other water management systems. The garden hose is made of high-quality PVC, which is durable. The water ho more→se is also equipped with a foot valve and a strainer to prevent the entry of larger debris.

Professional-Quality Lay-Flat Hose This versatile lay-flat hose is a home and workplace essential that can help you tackle a massive range of jobs.

?? Making Your Patio More Lively: KINDLY NOTED: NOT AVAILABLE FOR JET WASHER CONNECTOR. Upgrade NEW latex pipe with double layer latex core and...

Keep your outdoor space looking considered with the wall mounted Garden Hose Hanger from St Helens Home Garden. Designed to hold your hose pipe neatly when it’s not in use, it helps reduce clutter aro more→und the tap area and keeps your garden looking tidy day to day. Suitable for both standard and expandable hose pipes, it’s a practical choice for a range of garden set-ups. Installation is straightforward: the hanger simply hooks over your garden tap, making it an easy addition to your existing watering routine. Made from strong, durable ABS plastic and finished in green, it’s designed to sit discreetly against the garden backdrop while providing reliable hose storage. Key features Wall mounte…

The Gardena Classic Hose Reel Connection Set is designed to connect hose trolleys and reels to an outdoor water source, providing a convenient and reliable link between your tap and hose storage syste more→m. This essential accessory is specifically engineered for use with Gardena hose trolleys and reels, enabling easy setup of a complete watering system. Constructed from durable PVC, the connection hose is built to withstand pressures up to 22 bar, making it suitable for standard domestic water supplies and ensuring long-term reliability in regular use. The robust construction and quality materials are backed by an impressive 12 year warranty, providing peace of mind for both professional gardeners …

Compatible only with XF couplings. Free airflow rate at 100psi(7bar): 100-130cfm(2832-3681L/min). Manufactured in the UK. High Flow Rate - 130cfm at 100psi enhances tool efficiency. Hardened steel con more→struction with corrosive resistant finish. Features: • Compatible only with XF couplings • Free airflow rate at 100psi(7bar): 100-130cfm(2832-3681L/min) • Manufactured in the UK • High Flow Rate - 130cfm at 100psi enhances tool efficiency • Hardened steel construction with corrosive resistant finish Specifications: Guarantee:1 Year Model Number: AC86

Flexible nozzle made with durable Viton seals for improved resistance to chemical products. Suitable for Hozelock Killaspray pressure sprayers. Features & Benefits • Flat nozzle • Flexible t more→ube 25cm • Intensive use • High resistance Specifications • Hozelock Part Number: 4403 0000 • Lance Length: 250mm

Hozelock MICRO 360° sprinklers deliver a constant full circle, fine spray of water over an area of 700cm making them ideal for watering plants or vegetables in the centre of flower beds and vegeta more→ble gardens. Installation is quick and easy but can be individually tailored for complete water coverage over all plants no matter how complicated your garden layout. Use support stakes and Micro Extension hose, to water your plants from multiple elevations either above or below the foliage canopy. Features & Benefits • Micro sprinklers produce a high flow rate even at low pressures • The perfect solution for a fully customisable and water-saving irrigation system • Use: In-Line – 13…

Elevate Your Pet Care Routine with the KARCHER Pet Shower AccessoryTransform your Kärcher OC 3 mobile cleaner into the ultimate pet grooming station with the specially designed KARCHER Pet Shower Acce more→ssory. Say goodbye to the struggles of cleaning a muddy or anxious pet. This essential nozzle is engineered to make bath time a calm and pleasant experience for your furry companions, from the smallest pups to larger dogs. Ideal for pet owners who love outdoor adventures, this accessory ensures that mud, sand, and dirt stay outside, not in your car or home. It provides a quick, efficient, and gentle cleaning solution right where you need it, whether you´re at the park, the beach, or your own back ga…

Hozelock Garden Sprayer Extension Lance 4106 Extension Lance Extension Lance Manufactured from Fibreglass For extra reach when spraying Hozelock...

Kärcher Comfort Window Nozzle: The Ultimate Accessory for Streak-Free Glass CleaningUnlock the full potential of your Kärcher steam cleaner and achieve flawlessly clear, streak-free windows with the K more→ärcher Comfort Window Nozzle. This essential accessory from the Small appliances accessories and parts category is expertly engineered to transform the way you clean glass, mirrors, and other smooth surfaces, turning a tedious chore into a quick and satisfying task. Say goodbye to chemical sprays, paper towel residue, and frustrating streaks, and hello to a professional-grade clean using only the power of steam.Experience a Truly Streak-Free FinishThe core of the Kärcher Comfort Window Nozzle´s excep…

Introduction:Watersavingdevicecansavewatertothegreatestextentbyadjustingthedensity,sizeandscaleofwater.

Thisgardenautomaticwatertimerallowsyoutowateryourgardeninanorganisedwayregularly.Itisperfectforuseinsummerwhenplantsandgrassneedfrequentwatering.

The Hozelock universal hose hanger is an effective alternative to bulky hose reels and carts. It is a hose storage system that can hold up to 30m of...

Feature: 1. High Hardness: Patio misting cooling system is more durable. High rigidity. Strong pressure resistance and longer service life. No leakage. 2. Cooling Temperature: Our misting cooling syst more→em will cool down the surrounding environment. Cooling to 50?68 degrees F so you don t have to worry about ambient temperature. 3. Brass Nozzles: The nozzles of our outdoor mist cooling system are made of sophisticated brass with small diameter to produce a very fine mist. 4. Wide Application: Just connect the mist cooling system to the faucet and you can use it on the patio, garden, trampoline, backyard, agriculture, garden, greenhouse. 5. Save Water: Patio misting cooling system saves more water …

The 4.6mm L Joint Pipe Connector is specifically designed for making 90° turns in the Gardena Supply Pipe 4.6mm (3/16") (Art. No. 1348/1350). This smaller-diameter connector is ideal for fine-tuning w more→ater delivery in compact spaces and detailed irrigation layouts where precision is paramount. Supplied in a convenient pack of 10, this variant provides excellent value for larger installations or for keeping spares on hand for future system modifications. The Quick & Easy connection technology ensures that even novice gardeners can achieve professional results, with secure connections that remain watertight throughout the season. Features and Benefits: • Suitable for expanding and customising G…

The connection kit is an expansion kit for the Kärcher Rain System™ efficient watering system and contains 4 T-connectors, 4 I-connectors and 5 end pieces. The T-connectors connect three Kärcher Rain more→System™ hoses or soaker hoses together, the I-connector connects two. The lateral tee of the T-piece is volume-adjustable and thus pressure-adjustable and is ideal for connection of the soaker hose. The I-connector is most suitable for affixing the soaker hose to the end of the Kärcher Rain System™ hose or to connect two Kärcher Rain System™ hoses. With the help of the end piece, the laid or shortened hoses can be sealed at any point. Installation of the hoses does not require tools and is extre…